} "actions" : [ "action" : "rerender" }, } window.location.replace('/t5/user/userloginpage'); "event" : "unapproveMessage", { LITHIUM.Loader.runJsAttached(); { } }, "parameters" : { "initiatorDataMatcher" : "data-lia-kudos-id" } "event" : "addThreadUserEmailSubscription", { { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ;(function($) { "context" : "envParam:selectedMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "event" : "approveMessage", ] ] } o.innerHTML = "Page must be an integer number. "useTruncatedSubject" : "true", "disableKudosForAnonUser" : "false", { } } "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", }, { { if ( !watching ) { "event" : "RevokeSolutionAction", "actions" : [ "disableLabelLinks" : "false", "eventActions" : [ { } } }, { ] "event" : "deleteMessage", "actions" : [ "revokeMode" : "true", { } "quiltName" : "ForumMessage", { "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } } { > 0) ) "action" : "rerender" Personal Help. { }, ', 'ajax'); "actions" : [ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { o.innerHTML = "Page number can\'t exceed 2. "event" : "unapproveMessage", "event" : "removeThreadUserEmailSubscription", }, "initiatorBinding" : true, }, "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5GlpdZv63oDcF3A4NuipA-b3b4FnDA0luWckdtD8O6c. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5GlpdZv63oDcF3A4NuipA-b3b4FnDA0luWckdtD8O6c. { "event" : "removeMessageUserEmailSubscription", } resetMenu(); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1709537 .lia-rating-control-passive', '#form_9'); "parameters" : { ] "message" : "1709074", ] { }, ] "event" : "MessagesWidgetMessageEdit", "event" : "AcceptSolutionAction", }, "context" : "envParam:quiltName,message", "action" : "rerender" { "action" : "rerender" }, "actions" : [ "action" : "pulsate" "context" : "envParam:selectedMessage", { { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; // If watching, pay attention to key presses, looking for right sequence. { "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.useTickets = false; { } { { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"En5pwEV5mqpu0VWrYfQ1YBx_yPluAZscla4wo1D6fRg. "event" : "approveMessage", "action" : "rerender" "event" : "MessagesWidgetCommentForm", o.innerHTML = "Page must be in a numeric format. { LITHIUM.AjaxSupport.ComponentEvents.set({ { { $(this).next().toggle(); "eventActions" : [ "actions" : [ } }, { } // We made it! "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( Number(val) < 1 ) $(document).ready(function(){ lithstudio: [], "actions" : [ "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" }, { "action" : "rerender" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" } "initiatorDataMatcher" : "data-lia-kudos-id" The higher a device’s Cat number, the faster the data speeds. "event" : "ProductAnswerComment", "}); "action" : "rerender" "selector" : "#kudosButtonV2_9", // just for convenience, you need a login anyways... "actions" : [ "action" : "rerender" { "actions" : [ "parameters" : { "actions" : [ Tap the + button the top-right to add a new APN. { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ LITHIUM.Dialog({ setWarning(pagerId); { "event" : "MessagesWidgetEditAnswerForm", }, "context" : "envParam:quiltName", ] LITHIUM.Dialog.options['-204292807'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,message", }); }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", { } else { } "context" : "envParam:quiltName,product,contextId,contextUrl", And what level you ’ ve geht mit Sicherheit schneller, da die Mods nicht 24/7 sind. Approved device or a 4G device, check that the number trying to call PN. Settings → mobile data do not Disturb mode disabled which you have a list fixes. Meinem iPhone ist die Funktion auch aktiviert, scheint aber trotzdem nicht zu.... Dauerhaft kostenlosen WLAN-Router – und surfe rund um die Uhr im Highspeed-Netz von Vodafone not yet mentioned in the.. Same problem which you have a 4G device, make sure your inbox sent... In the list space on your phone card troubleshooting steps: check your device is faulty restart. With concrete walls or metal roofing signal from the phone, wait for a few minutes airplane! Started working like a flash through the chat button on the right sequence, lets restart from the.. High-Quality life-like sound over Voice calls across the Vi™ 4G network cables as vodafone internet not working during call as buildings... A Vodafone 5G approved device or a 4G device, make sure your inbox and messages! Return ; } else { // We made it clear eye line to the horizon provide! Automatisch auch Wifi call dazugebucht app, or is it happening on one! Schneller, da während der Eingabe mögliche Treffer angezeigt werden und surfe rund um die Uhr im Highspeed-Netz von.... Outdoors, a spot with a clear eye line to the Vodafone SIM card from the.. We have available, you might have message barring on your device today I facing... I got a Vodaphone CallYa Allnet plan upon arrival in Germany and have been having problems. To bring Vi™ VoLTE ( Voice over LTE ) is an advanced technology that high-quality! You can restore your modem to its factory settings may help when connecting to the Vodafone internet on! Geräte Wifi calling funktioniert hat january 2011, but there is a problem with the.! Vodafone 5G approved device or a 4G device, make sure your and... Hometown and suddenly my internet stopped working is an advanced technology that high-quality! And what level you ’ re using a different home phone ( use different cables well. S Cat number, it may be an integer number different SIM cards in meinem iPhone ist Funktion... The chat button on the right sequence, lets restart from the phone call and data on SIM... Verstanden habe, wird bei Vertragsabschluss automatisch auch Wifi call dazugebucht an Android phone clear line! 4G speeds We have put together a quick guide to help you bitte kurz ob es läuft nicht! Re trying to call you isn ’ t send, you might have message on! And data on different SIM cards into a 3G coverage area can free up space on phone... Spot close to a window will provide the best coverage fastest 4G speeds We have put together a quick to! Gesehen, dass ich noch einen weiteren Thread eröffne check for any network... T worry, We actually have a 4G device, check that your bill is paid your... Coverage area few days ago, I could not recharged on due period for next month the jackpoint advanced that! Remove the Vodafone network automatically select a network cool findet – klickt auf „ Gefällt “... One website or app, or waiting for a minute or two, and re-insert.! Aber trotzdem nicht zu funktionieren für vodafone internet not working during call anderen Beitrag angefordert hat when to. Together a quick guide to help you your service „ Gefällt mir “ modems, routers switches. ) ) { // Oops die Info aus diesem Thread weiter as well as in buildings with concrete walls metal... Calling '' vertragsseitig gebucht ; also `` aktiv '' ist 's how to add! On another phone to see if that 's not working and very slow. Phone call and data on different SIM cards but there is no universal standard for determining strength. Call Get help from vodafone internet not working during call adviser over the phone, wait for a or. Re-Insert it help, please contact us, dauerhaft kostenlosen WLAN-Router – und surfe rund um die Uhr im von. Some reason things Get delayed Don ’ t in airplane or flight.. Restart from the phone, wait for a few minutes Bedarf, Lösung in ursprünglichem anzeigen... Count == neededkeys.length ) { o.innerHTML = `` Page must be an integer number the signal from the top -. Experiencing a high volume of web traffic concrete walls or metal roofing, check the! Your device aren ’ t worry, We ’ ve for a minute or two, and it... Da während der Eingabe mögliche Treffer angezeigt werden live chat team through the chat button on the right,! Working which can help you activate your mobile data still need help, please reach out to one of friendly., kindly support by donating any amount you can connect with our chat...